PDB entry 2v5q

View 2v5q on RCSB PDB site
Description: crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Class: transferase complex
Keywords: design ankyrin repeat protein, transferase complex, phosphorylation, nucleotide-binding, serine/threonine-protein kinase, kinase, nucleus, transferase, ATP-binding, serine/threonine protein kinase
Deposited on 2007-07-08, released 2008-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-01, with a file datestamp of 2008-03-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18395
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2V5Q (Start-136)
    • Uniprot P53350
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2V5Q (Start-136)
    • Uniprot P53350
  • Chain 'C':
    Compound: design ankyrin repeat protein
    Species: UNIDENTIFIED, synthetic
    Domains in SCOP 1.75: d2v5qc1
  • Chain 'D':
    Compound: design ankyrin repeat protein
    Species: UNIDENTIFIED, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v5qC (C:)
    mrgshhhhhhgsdlgkklleaaragqddevriliangadvnavdntgltplhlaavsghl
    eivevllkhgadvdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhla
    adeghleivevllkygadvnaqdkfgktafdisidngnedlakscrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5qC (C:)
    sdlgkklleaaragqddevriliangadvnavdntgltplhlaavsghleivevllkhga
    dvdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivev
    llkygadvna
    

  • Chain 'D':
    No sequence available.