PDB entry 2v5q
View 2v5q on RCSB PDB site
Description: crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Class: transferase
Keywords: design ankyrin repeat protein, transferase complex, phosphorylation, nucleotide-binding, serine/threonine-protein kinase, kinase, nucleus, transferase, ATP-binding, serine/threonine protein kinase
Deposited on
2007-07-08, released
2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-02-20, with a file datestamp of
2019-02-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Serine/threonine-protein kinase PLK1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Serine/threonine-protein kinase PLK1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: design ankyrin repeat protein
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2v5qc1, d2v5qc2 - Chain 'D':
Compound: design ankyrin repeat protein
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2v5qC (C:)
mrgshhhhhhgsdlgkklleaaragqddevriliangadvnavdntgltplhlaavsghl
eivevllkhgadvdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhla
adeghleivevllkygadvnaqdkfgktafdisidngnedlakscrn
Sequence, based on observed residues (ATOM records): (download)
>2v5qC (C:)
sdlgkklleaaragqddevriliangadvnavdntgltplhlaavsghleivevllkhga
dvdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivev
llkygadvna
- Chain 'D':
No sequence available.