PDB entry 2v5p

View 2v5p on RCSB PDB site
Description: complex structure of human igf2r domains 11-13 bound to igf-II
Class: receptor/glycoprotein
Keywords: receptor/glycoprotein, cation independent mannose 6-phosphate, membrane, receptor, lysosome, transport, beta barrel, phosphorylation, fibronectin type II, insulin-like growth factor, receptor/glycoprotein complex, polymorphism, glycoprotein, transmembrane
Deposited on 2007-07-06, released 2007-12-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.293
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717
      • conflict see remark 9 (195)
    • PDB 2V5P
  • Chain 'B':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717
      • conflict see remark 9 (195)
    • PDB 2V5P
  • Chain 'C':
    Compound: insulin-like growth factor II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v5pc1
  • Chain 'D':
    Compound: insulin-like growth factor II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v5pd1
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2v5pC (C:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

    Sequence, based on observed residues (ATOM records): (download) 
    >2v5pC (C:)
etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >2v5pD (D:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

    Sequence, based on observed residues (ATOM records): (download) 
    >2v5pD (D:)
etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp