PDB entry 2v5p
View 2v5p on RCSB PDB site
Description: complex structure of human igf2r domains 11-13 bound to igf-II
Class: receptor/glycoprotein
Keywords: receptor/glycoprotein, cation independent mannose 6-phosphate, membrane, receptor, lysosome, transport, beta barrel, phosphorylation, fibronectin type II, insulin-like growth factor, receptor-glycoprotein complex, polymorphism, glycoprotein, transmembrane
Deposited on
2007-07-06, released
2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-06-29.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: N/A
AEROSPACI score: 0.09
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cation-independent mannose-6-phosphate receptor
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: cation-independent mannose-6-phosphate receptor
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: insulin-like growth factor II
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2v5pc1 - Chain 'D':
Compound: insulin-like growth factor II
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2v5pd1 - Heterogens: NAG
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2v5pC (C:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse
Sequence, based on observed residues (ATOM records): (download)
>2v5pC (C:)
etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2v5pD (D:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse
Sequence, based on observed residues (ATOM records): (download)
>2v5pD (D:)
etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp