PDB entry 2v5p

View 2v5p on RCSB PDB site
Description: complex structure of human igf2r domains 11-13 bound to igf-II
Class: receptor/glycoprotein
Keywords: receptor/glycoprotein, cation independent mannose 6-phosphate, membrane, receptor, lysosome, transport, beta barrel, phosphorylation, fibronectin type II, insulin-like growth factor, receptor-glycoprotein complex, polymorphism, glycoprotein, transmembrane
Deposited on 2007-07-06, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717
      • conflict (195)
    • PDB 2V5P
  • Chain 'B':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717
      • conflict (195)
    • PDB 2V5P
  • Chain 'C':
    Compound: insulin-like growth factor II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v5pc1
  • Chain 'D':
    Compound: insulin-like growth factor II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v5pd1
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v5pC (C:)
    ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
    atpakse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5pC (C:)
    etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v5pD (D:)
    ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
    atpakse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5pD (D:)
    etlcggelvdtlqfvcgdrgfyfsrgiveeccfrscdlalletycatp