PDB entry 2v5f

View 2v5f on RCSB PDB site
Description: Crystal structure of wild type peptide-binding domain of human type I collagen prolyl 4-hydroxylase.
Class: oxidoreductase
Keywords: endoplasmic reticulum, metal-binding, oxidoreductase
Deposited on 2008-10-06, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl 4-hydroxylase subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5fa_
  • Chain 'X':
    Compound: hexa-histidine peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V5F (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2v5fA (A:)
mfltaedcfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
dldkallltkklleldpehqrangnlkyfeyimakekdvnksas

    Sequence, based on observed residues (ATOM records): (download) 
    >2v5fA (A:)
fltaedcfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqgd
ldkallltkklleldpehqrangnlkyfeyimakekd

  • Chain 'X':
    No sequence available.