PDB entry 2v5b

View 2v5b on RCSB PDB site
Description: the monomerization of triosephosphate isomerase from trypanosoma cruzi
Class: isomerase
Keywords: tim, unfolding, monotctim, isomerase, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt, monomerization, fatty acid biosynthesis, triosephosphate isomerase
Deposited on 2008-10-02, released 2008-11-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2137
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52270 (76-243)
    • PDB 2V5B (68-75)
    Domains in SCOPe 2.01: d2v5ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v5bA (A:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnagnadalaslkdygiswvvlghserrlyygetneivaekvaqacaagfhvivc
    vgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpqqaqev
    hellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpefveii
    eatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5bA (A:)
    skpqpiaaanwkcllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfqiaaqn
    agnadalaslkdygiswvvlghserrlyygetneivaekvaqacaagfhvivcvgetnee
    reagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpqqaqevhellrrw
    vrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpefveiieatk