PDB entry 2v4z

View 2v4z on RCSB PDB site
Description: The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an engineered regulator of G-protein signaling type 2 domain (RGS2)
Class: cell cycle
Keywords: GTP hydrolysis, ADP-ribosylation, nucleotide-binding, lipoprotein, GTP-binding, phosphoprotein, signal transduction inhibitor, guanine nucleotide binding protein, transmembrane signaling, g-protein coupled receptor, palmitate, myristate, transducer, cell cycle
Deposited on 2008-09-30, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(k) subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Regulator of G-protein signaling 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V4Z
      • engineered mutation (38)
      • engineered mutation (116)
      • engineered mutation (123)
    • Uniprot P41220
    Domains in SCOPe 2.08: d2v4zb_
  • Heterogens: GDP, ALF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v4zB (B:)
    snakpspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkktkspqk
    lsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmendsyp
    rflksefyqdlckkpqitteph
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4zB (B:)
    pspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkspqklsskark
    iytdfiekeapkeinidfqtktliaqnatsgcfttaqkrvyslmendsyprflksefyqd
    lc