PDB entry 2v4z

View 2v4z on RCSB PDB site
Description: The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an engineered regulator of G-protein signaling type 2 domain (RGS2)
Class: cell cycle
Keywords: GTP hydrolysis, ADP-ribosylation, nucleotide-binding, lipoprotein, GTP-binding, phosphoprotein, signal transduction inhibitor, guanine nucleotide binding protein, transmembrane signaling, g-protein coupled receptor, palmitate, myristate, transducer, cell cycle
Deposited on 2008-09-30, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Guanine nucleotide-binding protein G(k) subunit alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V4Z
  • Uniprot P08754
• Chain 'B':
  Compound: Regulator of G-protein signaling 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V4Z
    • engineered mutation (38)
    • engineered mutation (116)
    • engineered mutation (123)
  • Uniprot P41220
  Domains in SCOPe 2.08: d2v4zb_
• Heterogens: GDP, ALF, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2v4zB (B:)
  snakpspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkktkspqk
  lsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmendsyp
  rflksefyqdlckkpqitteph
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v4zB (B:)
  pspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkspqklsskark
  iytdfiekeapkeinidfqtktliaqnatsgcfttaqkrvyslmendsyprflksefyqd
  lc