PDB entry 2v4y

View 2v4y on RCSB PDB site
Description: the structure of e. coli ump kinase in complex with its allosteric regulator GTP
Class: transferase
Keywords: nucleotide-binding, pyrimidine biosynthesis, transferase, ATP-binding, allosteric enzyme, GTP, kinase, allostery, nmp kinase
Deposited on 2008-09-30, released 2008-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7E9 (Start-240)
      • engineered mutation (158)
    Domains in SCOPe 2.05: d2v4ya_
  • Chain 'B':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7E9 (Start-240)
      • engineered mutation (158)
    Domains in SCOPe 2.05: d2v4yb_
  • Chain 'C':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7E9 (Start-240)
      • engineered mutation (158)
    Domains in SCOPe 2.05: d2v4yc_
  • Chain 'D':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7E9 (Start-240)
      • engineered mutation (158)
    Domains in SCOPe 2.05: d2v4yd_
  • Chain 'E':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7E9 (Start-240)
      • engineered mutation (158)
    Domains in SCOPe 2.05: d2v4ye_
  • Chain 'F':
    Compound: uridylate kinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7E9 (Start-240)
      • engineered mutation (158)
    Domains in SCOPe 2.05: d2v4yf_
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v4yA (A:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4yA (A:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
    eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v4yB (B:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4yB (B:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftptatmyeqltys
    evlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v4yC (C:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4yC (C:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
    eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v4yD (D:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4yD (D:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvfakdptatmyeqlt
    ysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v4yE (E:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4yE (E:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpadptatmye
    qltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v4yF (F:)
    matnakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnl
    frgaglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswa
    eaisllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdpt
    atmyeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlit
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4yF (F:)
    akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
    glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
    llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftkdptatmyeqlt
    ysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite