PDB entry 2v4o

View 2v4o on RCSB PDB site
Description: crystal structure of salmonella typhimurium sure at 2.75 angstrom resolution in monoclinic form
Class: hydrolase
Keywords: mononucleotidase, survival protein, stationary phase, sur e, hydrolase, phosphatase, divalent metal ion, nucleotide-binding, multifunctional enzyme, rossmann fold, metal-binding, domain swapping
Deposited on 2008-09-26, released 2008-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.19271
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multifunctional protein sur e
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V4O (Start-13)
    • Uniprot P66881 (14-266)
    Domains in SCOPe 2.07: d2v4oa1, d2v4oa2
  • Chain 'B':
    Compound: multifunctional protein sur e
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V4O (Start-13)
    • Uniprot P66881 (14-266)
    Domains in SCOPe 2.07: d2v4ob1, d2v4ob2
  • Chain 'C':
    Compound: multifunctional protein sur e
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V4O (Start-13)
    • Uniprot P66881 (14-266)
    Domains in SCOPe 2.07: d2v4oc1, d2v4oc2
  • Chain 'D':
    Compound: multifunctional protein sur e
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V4O (Start-13)
    • Uniprot P66881 (14-266)
    Domains in SCOPe 2.07: d2v4od1, d2v4od2
  • Heterogens: MG, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v4oA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4oA (A:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v4oB (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4oB (B:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v4oC (C:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4oC (C:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v4oD (D:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4oD (D:)
    hgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtft
    fdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrh
    lgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtr
    cgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahs
    ahdvvsdwldsvgvgtqw