PDB entry 2v47

View 2v47 on RCSB PDB site
Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
Class: ribosome
Keywords: ribosome, rrf, recycling, tRNA, mRNA, translation
Deposited on 2007-06-28, released 2007-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.265
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47 (0-0)
      • conflict (5)
      • conflict (7)
    • Uniprot P60493 (1-84)
  • Chain '1':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47 (0-0)
    • Uniprot Q5SHQ6 (1-59)
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v4741
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47
    • Uniprot P80339 (1-59)
    Domains in SCOPe 2.06: d2v4751
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v4761
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v4771
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47
    • Uniprot P80341 (1-64)
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47c1
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47
    • Uniprot P60405 (1-End)
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47e1
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47f1
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47
    • Uniprot Q5SHQ0 (1-181)
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47h1, d2v47h2
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47n1
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47p1
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47t1
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V47
    • Uniprot P60491 (1-117)
    Domains in SCOPe 2.06: d2v47u1
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47v1
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47y1
  • Chain 'Z':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v47z1

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2v474 (4:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfvdtegrverfq
    rrygdsyrkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v474 (4:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfv
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2v475 (5:)
    makhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v475 (5:)
    akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2v476 (6:)
    masevriklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v476 (6:)
    lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v477 (7:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

  • Chain '8':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v47C (C:)
    mpkhgkryrallekvdpnkvytideaarlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47C (C:)
    kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
    keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
    reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
    vtttmgpsvri
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v47E (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47E (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v47F (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnriggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47F (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnrigg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2v47H (H:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47H (H:)
    pkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhgltrtl
    ianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrv
    rvsgidkqkvgqvaanirairkpsayhekgiyyagepvrl
    

  • Chain 'I':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2v47N (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47N (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpekle
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2v47P (P:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47P (P:)
    dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
    rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
    vvahafsksaleklkaaggepvllea
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2v47T (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqkaqepkasqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47T (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqka
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2v47U (U:)
    mpraktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrl
    wivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47U (U:)
    praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v47V (V:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2v47Y (Y:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47Y (Y:)
    rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
    ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2v47Z (Z:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v47Z (Z:)
    yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
    dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
    dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped