PDB entry 2v44

View 2v44 on RCSB PDB site
Description: crystal structure of ncam2 ig1-2
Class: cell adhesion
Keywords: cell adhesion, phosphorylation, immunoglobulin domain, neural cell adhesion molecule, ig, ncam2, membrane, homphilic, glycoprotein, transmembrane, immunoglobulin
Deposited on 2007-06-27, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.208
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15394 (0-188)
      • conflict (30)
      • conflict (53)
      • conflict (144)
    Domains in SCOPe 2.07: d2v44a1, d2v44a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v44A (A:)
    allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl
    tiynaniedagiyrcqatdakgqtqeatvvleiyqkltfrevvspqefkqgedaevvcrv
    ssspapavswlyhneevttisdnrfamlannnlqilninksdegiyrcegrveargeidf
    rdiivivnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v44A (A:)
    allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl
    tiynaniedagiyrcqatdakgqtqeatvvleiyqkltfrevvspqefkqgedaevvcrv
    ssspapavswlyhnvttisdnrfamlannnlqilninksdegiyrcegrveargeidfrd
    iivivnv