PDB entry 2v3z

View 2v3z on RCSB PDB site
Description: glu383ala escherichia coli aminopeptidase p in complex with substrate
Class: hydrolase
Keywords: 'pita-bread' enzyme, proline- specific enzyme, aminopeptidase p, manganese enzyme, protease, manganese, hydrolase, metal-binding, metalloenzyme, aminopeptidase, metalloprotease
Deposited on 2007-06-25, released 2007-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.14
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xaa-pro aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15034 (0-439)
      • engineered mutation (382)
    Domains in SCOPe 2.06: d2v3za1, d2v3za2
  • Chain 'B':
    Compound: tripeptide (valine-proline-leucine)
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V3Z (0-2)
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v3zA (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvapglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

  • Chain 'B':
    No sequence available.