PDB entry 2v3k

View 2v3k on RCSB PDB site
Description: the yeast ribosome synthesis factor emg1 alpha beta knot fold methyltransferase
Class: ribosomal protein
Keywords: ribosomal protein, emg1, rRNA processing, nuclear protein, ribonucleoprotein, ribosome biogenesis, alpha/beta knot fold methyltransferase
Deposited on 2007-06-18, released 2007-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: essential for mitotic growth 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v3ka_
  • Heterogens: SO4, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v3kA (A:)
    mvedsrvrdalkggdqkalpaslvpqappvltskdkitkrmivvlamaslethkissngp
    ggdkyvllncddhqgllkkmgrdisearpdithqclltlldspinkagklqvyiqtsrgi
    lievnptvriprtfkrfsglmvqllhklsirsvnseekllkviknpitdhlptkcrkvtl
    sfdapvirvqdyiekldddesicvfvgamargkdnfadeyvdekvglsnyplsasvacsk
    fchgaedawnilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v3kA (A:)
    pqappvltskdkitkrmivvlamaslethkiyvllncddhqgllkkmgrdisearpdith
    qclltlldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhklsirsv
    nseekllkviknpitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvgamargk
    dnfadeyvdekvglsnyplsasvacskfchgaedawni