PDB entry 2v3c
View 2v3c on RCSB PDB site
Description: crystal structure of the srp54-srp19-7s.s srp RNA complex of m. jannaschii
Class: signaling protein
Keywords: nucleotide-binding, signal recognition particle, RNA, GTP-binding, RNA-binding, ribonucleoprotein, signaling protein
Deposited on
2007-06-15, released
2007-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-03-24, with a file datestamp of
2009-03-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.16
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: signal recognition particle 19 kda protein
Species: Methanocaldococcus jannaschii [TaxId:2190]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2v3ca_ - Chain 'B':
Compound: signal recognition particle 19 kda protein
Species: Methanocaldococcus jannaschii [TaxId:2190]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2v3cb_ - Chain 'C':
Compound: signal recognition 54 kda protein
Species: Methanocaldococcus jannaschii [TaxId:2190]
Database cross-references and differences (RAF-indexed):
- PDB 2V3C (140-235)
- Uniprot Q57565 (1-425)
- Chain 'D':
Compound: signal recognition 54 kda protein
Species: Methanocaldococcus jannaschii [TaxId:2190]
Database cross-references and differences (RAF-indexed):
- PDB 2V3C (140-235)
- Uniprot Q57565 (1-425)
- Chain 'M':
Compound: 7s RNA
Species: METHANOCALDOCOCCUS JANNASCHII, synthetic [TaxId:2190]
- Chain 'N':
Compound: 7s RNA
Species: METHANOCALDOCOCCUS JANNASCHII, synthetic [TaxId:2190]
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2v3cA (A:)
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2v3cB (B:)
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.