PDB entry 2v3c

View 2v3c on RCSB PDB site
Description: crystal structure of the srp54-srp19-7s.s srp RNA complex of m. jannaschii
Class: signaling protein
Keywords: nucleotide-binding, signal recognition particle, RNA, GTP-binding, RNA-binding, ribonucleoprotein, signaling protein
Deposited on 2007-06-15, released 2007-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 19 kda protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2v3ca_
  • Chain 'B':
    Compound: signal recognition particle 19 kda protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2v3cb_
  • Chain 'C':
    Compound: signal recognition 54 kda protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V3C (140-235)
    • Uniprot Q57565 (1-425)
  • Chain 'D':
    Compound: signal recognition 54 kda protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V3C (140-235)
    • Uniprot Q57565 (1-425)
  • Chain 'M':
    Compound: 7s RNA
    Species: METHANOCALDOCOCCUS JANNASCHII, synthetic [TaxId:2190]
  • Chain 'N':
    Compound: 7s RNA
    Species: METHANOCALDOCOCCUS JANNASCHII, synthetic [TaxId:2190]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v3cA (A:)
    miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
    cgcvevdykgnklqllkeickiikgkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v3cB (B:)
    miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
    cgcvevdykgnklqllkeickiikgkn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.