PDB entry 2v3c

View 2v3c on RCSB PDB site
Description: crystal structure of the srp54-srp19-7s.s srp RNA complex of m. jannaschii
Class: signaling protein
Keywords: nucleotide-binding, signal recognition particle, RNA, GTP-binding, RNA-binding, ribonucleoprotein, signaling protein
Deposited on 2007-06-15, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: signal recognition particle 19 kda protein
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58440 (0-86)
  Domains in SCOPe 2.08: d2v3ca_
• Chain 'B':
  Compound: signal recognition particle 19 kda protein
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58440 (0-86)
  Domains in SCOPe 2.08: d2v3cb_
• Chain 'C':
  Compound: signal recognition 54 kda protein
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V3C (140-235)
  • Uniprot Q57565 (1-425)
• Chain 'D':
  Compound: signal recognition 54 kda protein
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V3C (140-235)
  • Uniprot Q57565 (1-425)
• Chain 'M':
  Compound: 7s RNA
  Species: METHANOCALDOCOCCUS JANNASCHII, synthetic [TaxId:2190]
  
• Chain 'N':
  Compound: 7s RNA
  Species: METHANOCALDOCOCCUS JANNASCHII, synthetic [TaxId:2190]
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v3cA (A:)
  miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
  cgcvevdykgnklqllkeickiikgkn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v3cB (B:)
  miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
  cgcvevdykgnklqllkeickiikgkn
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.