PDB entry 2v33
View 2v33 on RCSB PDB site
Description: High resolution crystal structure of domain III of E1 fusion glycoprotein of Semliki Forest Virus
Class: viral protein
Keywords: glycoprotein, transmembrane, viral protein
Deposited on
2007-06-11, released
2008-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-04-16, with a file datestamp of
2014-04-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.199
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: e1 envelope glycoprotein
Species: SEMLIKI FOREST VIRUS [TaxId:11033]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2v33a_ - Chain 'B':
Compound: e1 envelope glycoprotein
Species: SEMLIKI FOREST VIRUS [TaxId:11033]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2v33b_ - Heterogens: NO3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2v33A (A:)
eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
vtlhfstasaspsfvvslcsaratcsascep
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2v33B (B:)
eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
vtlhfstasaspsfvvslcsaratcsascep