PDB entry 2v31

View 2v31 on RCSB PDB site
Description: structure of first catalytic cysteine half-domain of mouse ubiquitin- activating enzyme
Deposited on 2007-06-11, released 2008-06-24
The last revision was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-activating enzyme e1 x
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02053 (2-111)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2v31A (A:)
    efgeemvltdsngeqplsamvsmvtkdnpgvvtcldearhgfetgdfvsfsevqgmiqln
    gcqpmeikvlgpytfsicdtsnfsdyirggivsqvkvpkkisfkslpaslve