PDB entry 2v2u

View 2v2u on RCSB PDB site
Description: Structure of Mouse gammaC-crystallin
Class: structural protein
Keywords: structural protein, eye lens protein
Deposited on 2007-06-07, released 2007-06-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma crystallin c
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v2ua1, d2v2ua2
  • Chain 'B':
    Compound: gamma crystallin c
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v2ub1, d2v2ub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2v2uA (A:)
gkitffedrsfqgrcyecssdcpnlqtyfsrcnsvrvdsgcwmlyerpnyqghqyflrrg
eypdyqqwmgfsdsirscrliphagshrmrlyekedhkgvmmelsedcsciqdrfhlsev
rslqvlegcwvlyempnyrgrqyllrpqeyrrfqdwgsvdakagslrrvvdly

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2v2uB (B:)
gkitffedrsfqgrcyecssdcpnlqtyfsrcnsvrvdsgcwmlyerpnyqghqyflrrg
eypdyqqwmgfsdsirscrliphagshrmrlyekedhkgvmmelsedcsciqdrfhlsev
rslqvlegcwvlyempnyrgrqyllrpqeyrrfqdwgsvdakagslrrvvdly