PDB entry 2v2d

View 2v2d on RCSB PDB site
Description: the a178l mutation in the c-terminal hinge of the flexible loop-6 of triosephosphate isomerase (tim) induces a more closed conformation of this hinge region in dimeric and monomeric tim
Class: isomerase
Keywords: gluconeogenesis, lipid synthesis, engineering, pentose shunt, point mutation, tim, a178l, loop6, hinge, loop-6, enzyme, isomerase, fatty acid biosynthesis, triosephosphate isomerase, glycosome, monomeric, tim-barrel, glycolysis
Deposited on 2007-06-05, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (71-241)
      • conflict (13)
      • conflict (16-17)
      • conflict (66-70)
      • conflict (72-73)
      • conflict (91)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d2v2da_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v2dA (A:)
    mskpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvltpqqaqeaha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v2dA (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvltpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q