PDB entry 2v21

View 2v21 on RCSB PDB site
Description: Crystal structure of the T. thermophilus dodecin in complex with prebound FMN
Class: flavoprotein
Keywords: hypothetical protein, flavin binding protein, dodecins, coenzyme a, flavin dimer, putative storage protein, flavoprotein
Deposited on 2007-05-31, released 2007-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ttha1431
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v21a_
  • Chain 'B':
    Compound: hypothetical protein ttha1431
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v21b_
  • Chain 'C':
    Compound: hypothetical protein ttha1431
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v21c_
  • Chain 'D':
    Compound: hypothetical protein ttha1431
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v21d_
  • Chain 'E':
    Compound: hypothetical protein ttha1431
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v21e_
  • Chain 'F':
    Compound: hypothetical protein ttha1431
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v21f_
  • Heterogens: FMN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v21A (A:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v21A (A:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v21B (B:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v21B (B:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v21C (C:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v21C (C:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v21D (D:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v21D (D:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v21E (E:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v21E (E:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v21F (F:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v21F (F:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet