PDB entry 2v1w

View 2v1w on RCSB PDB site
Description: Crystal structure of human LIM protein RIL (PDLIM4) PDZ domain bound to the C-terminal peptide of human alpha-actinin-1
Class: structural protein
Keywords: actin, stress, fibre dynamics, cytoskeleton, lim domain, metal-binding, phosphorylation, structural protein
Deposited on 2007-05-30, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pdz and lim domain protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V1W (86-89)
    • Uniprot P50479 (1-85)
    Domains in SCOPe 2.08: d2v1wa1, d2v1wa2
  • Chain 'B':
    Compound: pdz and lim domain protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V1W (86-89)
    • Uniprot P50479 (1-85)
    Domains in SCOPe 2.08: d2v1wb1, d2v1wb2, d2v1wb3
  • Heterogens: EDO, MG, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v1wA (A:)
    smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
    mthleaqnrikgchdhltlsvsrpegesdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v1wA (A:)
    mphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestelm
    thleaqnrikgchdhltlsvsrpegesdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v1wB (B:)
    smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
    mthleaqnrikgchdhltlsvsrpegesdl