PDB entry 2v1r

View 2v1r on RCSB PDB site
Description: yeast pex13 sh3 domain complexed with a peptide from pex14 at 2.1 a resolution
Class: protein transport
Keywords: protein transport, translocation, transmembrane, peptide complex, structural genomics, peroxisome
Deposited on 2007-05-29, released 2008-06-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1912
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal membrane protein pas20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v1ra_
  • Chain 'B':
    Compound: peroxisomal membrane protein pas20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v1rb_
  • Chain 'P':
    Compound: pex14
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: pex14
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: pex14
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v1rA (A:)
    isefgsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrt
    kngnigyipynyieiikrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v1rA (A:)
    dpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyip
    ynyieii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v1rB (B:)
    isefgsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrt
    kngnigyipynyieiikrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v1rB (B:)
    dpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyip
    ynyieiik
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.