PDB entry 2v1n

View 2v1n on RCSB PDB site
Description: solution structure of the region 51-160 of human kin17 reveals a winged helix fold
Deposited on 2007-05-27, released 2007-11-27
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kin homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V1N (0-0)
    • Uniprot O60870 (1-110)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2v1nA (A:)
gqrqlllasenpqqfmdyfseefrndflellrrrfgtkrvhnnivyneyishrehihmna
tqwetltdftkwlgreglckvdetpkgwyiqyidrdpetirrqlelekkkk