PDB entry 2v1i

View 2v1i on RCSB PDB site
Description: crystal structure of radiation-induced metmyoglobin - aqua ferrous myoglobin at ph 6.8
Class: oxygen transport
Keywords: oxygen transport, oxygen activation, monooxygenase, metal-binding, muscle protein, reaction intermediate, haem, iron, heme, transport, radiation
Deposited on 2007-05-24, released 2007-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.139
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v1ia_
  • Heterogens: HEM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v1iA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg