PDB entry 2v1h

View 2v1h on RCSB PDB site
Description: crystal structure of radiation-induced metmyoglobin - aqua ferrous myoglobin at ph 5.2
Class: oxygen transport
Keywords: oxygen transport, oxygen activation, radiation, monooxygenase, metal-binding, muscle protein, reaction intermediate, iron, heme, transport, haem
Deposited on 2007-05-24, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.133
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
  Domains in SCOPe 2.08: d2v1ha_
• Heterogens: HEM, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v1hA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg