PDB entry 2v1f

View 2v1f on RCSB PDB site
Description: crystal structure of radiation-induced myoglobin compound II- intermediate h at ph 8.7
Class: oxygen transport
Keywords: muscle protein, oxygen transport, oxygen activation, peroxidase, monooxygenase, metal-binding, reaction intermediate, heme, ferryl, transport, haem, iron, radiation
Deposited on 2007-05-24, released 2007-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.135
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: EQUUS CABALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
  Domains in SCOP 1.73: d2v1fa1
• Heterogens: SO4, HEM, HYD, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v1fA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg