PDB entry 2v1f

View 2v1f on RCSB PDB site
Description: crystal structure of radiation-induced myoglobin compound II - intermediate h at ph 8.7
Class: oxygen transport
Keywords: muscle protein, oxygen transport, oxygen activation, peroxidase, monooxygenase, metal-binding, reaction intermediate, heme, ferryl, transport, haem, iron, radiation
Deposited on 2007-05-24, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.135
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
  Domains in SCOPe 2.07: d2v1fa_
• Heterogens: HEM, OH, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v1fA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg