PDB entry 2v1e

View 2v1e on RCSB PDB site
Description: crystal structure of radiation-induced myoglobin compound II - intermediate h at ph 6.8
Class: oxygen transport
Keywords: hydroxy radical, oxygen transport, oxygen activation, haem, iron, heme, ferryl, transport, peroxidase, reaction intermediate, monooxygenase, metal-binding, muscle protein
Deposited on 2007-05-23, released 2007-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.15
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
  Domains in SCOPe 2.06: d2v1ea_
• Heterogens: HEM, OH, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v1eA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg