PDB entry 2v1c

View 2v1c on RCSB PDB site
Description: crystal structure and mutational study of recor provide insight into its role in DNA repair
Class: recombination
Keywords: homologous recombination, recfor pathway, DNA recombination, recombination, DNA binding, zinc-finger, metal-binding, recor complex, hypothetical protein, deinococcus radiodurans, recr, zinc, reco, DNA damage, DNA repair
Deposited on 2007-05-23, released 2007-07-03
The last revision prior to the SCOP 1.75 freeze date was dated 2007-07-03, with a file datestamp of 2007-06-29.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.458
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination protein recr
    Species: DEINOCOCCUS RADIODURANS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v1ca1
  • Chain 'B':
    Compound: recombination protein recr
    Species: DEINOCOCCUS RADIODURANS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v1cb1
  • Chain 'C':
    Compound: hypothetical protein
    Species: DEINOCOCCUS RADIODURANS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v1cA (A:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskpqppqrpgdedgadgaavpasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v1cA (A:)
    kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
    nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
    lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
    devtlgraltgrqtvskpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v1cB (B:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskpqppqrpgdedgadgaavpasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v1cB (B:)
    kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
    nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
    lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
    devtlgraltgrqtvskpq
    

  • Chain 'C':
    No sequence available.