PDB entry 2v1b

View 2v1b on RCSB PDB site
Description: n- and c-terminal helices of oat lov2 (404-546) are involved in light- induced signal transduction (room temperature (293k) light structure of lov2 (404-546))
Deposited on 2007-05-22, released 2007-12-11
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nph1-1
    Species: AVENA SATIVA [TaxId:4498]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V1B (0-0)
    • Uniprot O49003 (1-143)
  • Heterogens: FMN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2v1bA (A:)
flattlerieknfvitdprlpdnpiifasdsflqlteysreeilgrncrflqgpetdrat
vrkirdaidnqtevtvqlinytksgkkfwnlfhlqpmrdqkgdvqyfigvqldgtehvrd
aaeregvmlikktaenideaakel