PDB entry 2v0l

View 2v0l on RCSB PDB site
Description: characterization of substrate binding and catalysis of the potential antibacterial target n-acetylglucosamine-1-phosphate uridyltransferase (glmu)
Class: transferase
Keywords: glmu, cell wall, magnesium, cell shape, transferase, peptidoglycan synthesis, multifunctional enzyme, nucleotidyltransferase, uridylation, metal-binding, acyltransferase, catalytic mechanism, associative mechanism
Deposited on 2007-05-14, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v0la1, d2v0la2
  • Heterogens: URI, PG4, PGE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v0lA (A:)
    mtkkalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggd
    lmrthlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketlekliea
    kpengialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasf
    kkwlarvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfq
    nkqasklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlkn
    vvigndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgsk
    vnhltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangat
    igagttitrdvgenelvitrvaqrhiqgwqrpikkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v0lA (A:)
    kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
    thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
    ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
    larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
    asklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvi
    gndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnh
    ltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatiga
    gttitrdvgenelvitrvaqrhiqgwqrpik