PDB entry 2v0e

View 2v0e on RCSB PDB site
Description: BRK domain from human CHD7
Class: hydrolase
Keywords: nucleotide-binding, chromatin regulator, charge syndrome, phosphorylation, disease mutation, transcription regulation, chd7, helicase, hydrolase, brk domain, ATP-binding, DNA-binding, transcription, nuclear protein
Deposited on 2007-05-14, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromodomain-helicase-DNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V0E (0-0)
    • Uniprot Q9P2D1 (1-54)
    Domains in SCOPe 2.08: d2v0ea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v0eA (A:)
    sgqldpdtripvinledgtrlvgedapknkdlvewlklhptytvdmpsyvpknad