PDB entry 2v07

View 2v07 on RCSB PDB site
Description: Structure of the Arabidopsis thaliana cytochrome c6A V52Q variant
Class: photosynthesis
Keywords: iron, heme, plastid, thylakoid, transport, chloroplast, metal-binding, photosynthesis, transit peptide, electron transfer, electron transport
Deposited on 2007-05-09, released 2007-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: ARABIDOPSIS THALIANA [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93VA3
      • engineered mutation (17)
      • engineered mutation (51)
    Domains in SCOPe 2.08: d2v07a_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v07A (A:)
    qtldiqrgatlfnraciachdtggniiqpgatlftkdlerngvdteeeiyrqtyfgkgrm
    pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwptvstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v07A (A:)
    diqrgatlfnraciachdtggniiqpgatlftkdlerngvdteeeiyrqtyfgkgrmpgf
    gekctprgqctfgprlqdeeikllaefvkfqadqgwptv