PDB entry 2v00

View 2v00 on RCSB PDB site
Description: x-ray crystal structure of endothiapepsin complexed with compound 1
Class: hydrolase
Keywords: fragment hit, b- secretase, endothiapepsin, bace, zymogen, protease, hydrolase, isocytosine, alzheimer's disease, fragment-based lead generation, aspartyl protease, surrogate protein
Deposited on 2007-05-03, released 2007-12-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.17
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v00a_
  • Heterogens: GOL, ACT, V15, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v00A (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask