PDB entry 2uzv

View 2uzv on RCSB PDB site
Description: pka structures of indazole-pyridine series of akt inhibitors
Class: transferase
Keywords: camp, kinase, myristate, transferase, lipoprotein, serine/threonine-protein kinase, phosphorylation, protein kinase a, nucleotide-binding, ATP-binding, akt inhibitors, nuclear protein
Deposited on 2007-05-01, released 2007-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.251
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '2':
    Compound: camp-dependent protein kinase inhibitor alpha,
    Species: BOS TAURUS, synthetic [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (0-335)
      • conflict (271)
    Domains in SCOPe 2.08: d2uzva_
  • Heterogens: SS5

PDB Chain Sequences:

  • Chain '2':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uzvA (A:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef