PDB entry 2uzs

View 2uzs on RCSB PDB site
Description: A transforming mutation in the pleckstrin homology domain of AKT1 in cancer (AKT1-PH_E17K)
Class: transferase
Keywords: transferase, glycogen biosynthesis, translation regulation, nucleotide- binding, glycogen metabolism, ATP-binding, sugar transport, nuclear protein, serine/threonine-protein kinase, transport, carbohydrate metabolism, kinase, apoptosis, phosphorylation, glucose metabolism
Deposited on 2007-05-01, released 2007-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RAC-alpha serine/threonine-protein kinase
  Species: Homo sapiens [TaxId:9606]
  Gene: AKT1, PKB, RAC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31749 (1-End)
    • expression tag (0)
    • engineered mutation (17)
  Domains in SCOPe 2.08: d2uzsa1, d2uzsa2
• Heterogens: 4IP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2uzsA (A:)
  smsdvaivkegwlhkrgkyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
  cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemd
  frsg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2uzsA (A:)
  smsdvaivkegwlhkrgkyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
  cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeee