PDB entry 2uzk

View 2uzk on RCSB PDB site
Description: Crystal structure of the human FOXO3a-DBD bound to DNA
Deposited on 2007-04-30, released 2008-05-13
The last revision was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.242
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: forkhead box protein o3a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UZK
  • Uniprot O43524
• Chain 'B':
  Compound: 5'-d(*cp*tp*ap*tp*gp*tp*ap*ap*ap*cp*ap*ap*c)-3'
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'C':
  Compound: forkhead box protein o3a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UZK (0-0)
  • Uniprot O43524 (1-End)
• Chain 'D':
  Compound: 5'-d(*cp*tp*ap*tp*gp*tp*ap*ap*ap*cp*ap*ap*c)-3'
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'E':
  Compound: 5'-d(*gp*tp*tp*gp*tp*tp*tp*ap*cp*ap*tp*ap*g)-3'
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'F':
  Compound: 5'-d(*gp*tp*tp*gp*tp*tp*tp*ap*cp*ap*tp*ap*g)-3'
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >2uzkA (A:)
  mgnlsyadlitraiesspdkrltlsqiyewmvrcvpyfkdkgdsnssagwknsirhnlsl
  hsrfmrvqnegtgksswwiinpdggksgkaprrravs
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records:
  

  >2uzkC (C:)
  mgnlsyadlitraiesspdkrltlsqiyewmvrcvpyfkdkgdsnssagwknsirhnlsl
  hsrfmrvqnegtgksswwiinpdggksgkaprrravs
  

  
  Sequence, based on observed residues (ATOM records):
  

  >2uzkC (C:)
  mgnlsyadlitraiesspdkrltlsqiyewmvrcvpyfkdkgdsnssagwknsirhnlsl
  hsrfmrvqnegtgksswwiinpdggksgkapr
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.