PDB entry 2uzg

View 2uzg on RCSB PDB site
Description: zf-ubp domain of vdu1
Class: hydrolase
Keywords: ubl conjugation pathway, de-ubiquitination, alternative splicing, metal-binding, thiol protease, ubl conjugation, zinc, vdu1, zf-ubp, protease, hydrolase, zinc-finger
Deposited on 2007-04-27, released 2007-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-11, with a file datestamp of 2007-09-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin carboxyl-terminal hydrolase 33
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2UZG
    • Uniprot Q8TEY7 (2-96)
    Domains in SCOP 1.75: d2uzga1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uzgA (A:)
    gsrnhcphldsvgeitkedliqkslgtcqdckvqgpnlwaclenrcsyvgcgesqvdhst
    ihsqetkhyltvnlttlrvwcyacskevfldrklgtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uzgA (A:)
    rnhcphldsvgeitkedliqkslgtcqdckvqgpnlwaclenrcsyvgcgesqvdhstih
    sqetkhyltvnlttlrvwcyacskevfldrklgtq