PDB entry 2uzg

View 2uzg on RCSB PDB site
Description: Zf-UBP domain of VDU1
Class: hydrolase
Keywords: ubl conjugation pathway, de-ubiquitination, alternative splicing, metal-binding, thiol protease, ubl conjugation, zinc, vdu1, zf-ubp, protease, hydrolase, zinc-finger
Deposited on 2007-04-27, released 2007-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin carboxyl-terminal hydrolase 33
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UZG
  • Uniprot Q8TEY7 (2-96)
  Domains in SCOPe 2.08: d2uzga1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2uzgA (A:)
  gsrnhcphldsvgeitkedliqkslgtcqdckvqgpnlwaclenrcsyvgcgesqvdhst
  ihsqetkhyltvnlttlrvwcyacskevfldrklgtq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2uzgA (A:)
  rnhcphldsvgeitkedliqkslgtcqdckvqgpnlwaclenrcsyvgcgesqvdhstih
  sqetkhyltvnlttlrvwcyacskevfldrklgtq