PDB entry 2uza

View 2uza on RCSB PDB site
Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
Class: oxidoreductase
Keywords: tpp-dependent enzyme, pyruvate catabolism, oxidoreductase, electron transport
Deposited on 2007-04-27, released 2008-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.171
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate ferredoxin oxidoreductase
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uzaa1, d2uzaa2, d2uzaa3, d2uzaa4, d2uzaa5
  • Chain 'B':
    Compound: pyruvate ferredoxin oxidoreductase
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uzab1, d2uzab2, d2uzab3, d2uzab4, d2uzab5
  • Heterogens: SF4, HTL, MG, CA, CO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uzaA (A:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uzaB (B:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk