PDB entry 2uz9

View 2uz9 on RCSB PDB site
Description: human guanine deaminase (guad) in complex with zinc and its product xanthine.
Class: hydrolase
Keywords: zinc, hydrolase, purine metabolism, guanine aminohydrolase
Deposited on 2007-04-26, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine deaminase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uz9a1, d2uz9a2
  • Heterogens: ZN, XAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uz9A (A:)
    mhhhhhhssgvdlgtenlyfqsmcaaqmpplahifrgtfvhstwtcpmevlrdhllgvsd
    sgkivfleeasqqeklakewcfkpceirelshheffmpglvdthihasqysfagssidlp
    llewltkytfpaehrfqnidfaeevytrvvrrtlkngtttacyfatihtdssllladitd
    kfgqrafvgkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpivtprfslsc
    setlmgelgniaktrdlhiqshisenrdeveavknlypsyknytsvydknnlltnktvma
    hgcylsaeelnvfhergasiahcpnsnlslssgflnvlevlkhevkiglgtdvaggysys
    mldairravmvsnillinkvneksltlkevfrlatlggsqalgldgeignfevgkefdai
    linpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfsssv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uz9A (A:)
    plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire
    lshheffmpglvdthihasqysfagssidlpllewltkytfpaehrfqnidfaeevytrv
    vrrtlkngtttacyfatihtdssllladitdkfgqrafvgkvcmdlndtfpeykettees
    iketerfvsemlqknysrvkpivtprfslscsetlmgelgniaktrdlhiqshisenrde
    veavknlypsyknytsvydknnlltnktvmahgcylsaeelnvfhergasiahcpnsnls
    lssgflnvlevlkhevkiglgtdvaggysysmldairravmvsnillinkvneksltlke
    vfrlatlggsqalgldgeignfevgkefdailinpkasdspidlfygdffgdiseaviqk
    flylgddrnieevyvggkqvvpfs