PDB entry 2uyz

View 2uyz on RCSB PDB site
Description: non-covalent complex between ubc9 and sumo1
Class: ligase
Keywords: sumoylation, cell division, nuclear protein, ubiquitin-like modifier, ubl conjugation pathway, conjugating enzyme, chromosome partition, e2, ubc9, sumo1, ligase, mitosis, cell cycle
Deposited on 2007-04-21, released 2007-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-07-03, with a file datestamp of 2007-06-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.143
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-conjugating enzyme UBC9
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63280 (Start-157)
      • engineered mutation (92)
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYZ (0-0)
    • Uniprot P63165 (1-End)
    Domains in SCOP 1.73: d2uyzb1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uyzB (B:)
    meyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
    elgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyzB (B:)
    meyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
    elgmeeedvievyqeqtg