PDB entry 2uyr

View 2uyr on RCSB PDB site
Description: Crystal structure of Bacillus cereus sphingomyelinase mutant :N57A
Class: hydrolase
Keywords: hydrolase, n57a metal ion of side-edge, bacillus cereus sphingomyelinase, hemolysis, cytolysis
Deposited on 2007-04-12, released 2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: sphingomyelinase c
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11889
      • engineered mutation (56)
      • conflict (295)
    Domains in SCOPe 2.08: d2uyrx_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2uyrX (X:)
    easttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdasas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyrX (X:)
    ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdasasdrllgn
    lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpd
    nlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipn
    neyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpd
    spaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism