PDB entry 2uyl

View 2uyl on RCSB PDB site
Description: Crystal structure of a monoclonal antibody directed against an antigenic determinant common to Ogawa and Inaba serotypes of Vibrio cholerae O1
Class: immune system
Keywords: fab fragment, monoclonal antibody, immune system, immunoglobulin domain, immunoglobulin c region, anti-lps vibrio cholerae
Deposited on 2007-04-10, released 2008-05-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uyla1, d2uyla2
  • Chain 'B':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uylb1
  • Chain 'M':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uylm1, d2uylm2
  • Chain 'N':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uyln1
  • Chain 'V':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uylv1, d2uylv2
  • Chain 'W':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uylw1
  • Chain 'X':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uylx1, d2uylx2
  • Chain 'Y':
    Compound: monoclonal antibody f-22-30
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYL (0-End)
    Domains in SCOPe 2.05: d2uyly1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uylA (A:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylA (A:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uylB (B:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylB (B:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsqtvtcnvahpasstkvdkkivprd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2uylM (M:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylM (M:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2uylN (N:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylN (N:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsqtvtcnvahpasstkvdkkivprd
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2uylV (V:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylV (V:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2uylW (W:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylW (W:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsqtvtcnvahpasstkvdkkivprd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2uylX (X:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylX (X:)
    elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2uylY (Y:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uylY (Y:)
    qvqleqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewighispgssstny
    nekfkskatltvdtssstaymqlssltsddsavyycgreetvrasfgnwgqgtlvtvsaa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsqtvtcnvahpasstkvdkkivprd