PDB entry 2uyi

View 2uyi on RCSB PDB site
Description: crystal structure of ksp in complex with ADP and thiophene containing inhibitor 33
Class: cell cycle
Keywords: ksp, eg5, complex, mitosis, thiophene, inhibitor, nucleotide-binding, kinesin spindle protein, motor protein, cell division, phosphorylation, cell cycle, microtubule, coiled coil, ATP-binding
Deposited on 2007-04-07, released 2007-05-22
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.24
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2uyia1
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2uyib1
  • Heterogens: MG, ADP, K02, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uyiA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyiA (A:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uyiB (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyiB (B:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnk