PDB entry 2uyh

View 2uyh on RCSB PDB site
Description: hhai DNA methyltransferase s87q-q237s mutant complex with 13mer gcgc-gmgc oligonucleotide and sah
Class: transferase
Keywords: transferase, s-adenosyl-l-methionine, base flipping, methyltransferase, restriction system, DNA methyltransferase
Deposited on 2007-04-06, released 2008-05-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • engineered mutation (86)
      • engineered mutation (236)
    Domains in SCOPe 2.01: d2uyha_
  • Chain 'C':
    Compound: 5'-d(*tp*gp*gp*ap*tp*g*5cmp*gp*cp*tp*gp *ap*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*tp*cp*ap*gp*cp*gp*cp*ap*tp *cp*c)-3'
  • Heterogens: SAH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2uyhA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsiqgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggsger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.