PDB entry 2uyd

View 2uyd on RCSB PDB site
Description: crystal structure of the smhasa mutant h83a
Class: metal-binding protein
Keywords: heme, iron, hemophore, heme binding, iron ligation, metal-binding, heme acquisition system, metal-binding protein
Deposited on 2007-04-04, released 2007-12-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: hemophore hasa
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54450 (0-End)
      • engineered mutation (82)
    Domains in SCOPe 2.01: d2uydx_
  • Heterogens: HEM, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2uydX (X:)
    mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
    anqvtafvaggnltytlfnepaatlygqldslsfgdglsggdtspysiqvpdvsfgglnl
    sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatavgvqha
    dspellaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uydX (X:)
    mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
    anqvtafvaggnltytlfnepaatlygqldslsfgdglsggdtspysiqvpdvsfgglnl
    sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatav