PDB entry 2uyc

View 2uyc on RCSB PDB site
Description: HhaI DNA methyltransferase R163N mutant complex with 13mer GCGC-GMGC oligonucleotide and SAH
Class: transferase
Keywords: transferase, s-adenosyl-l-methionine, base flipping, methyltransferase, restriction system, DNA methyltransferase
Deposited on 2007-04-03, released 2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • engineered mutation (162)
    Domains in SCOPe 2.08: d2uyca_
  • Chain 'C':
    Compound: 5'-d(*tp*gp*gp*ap*tp*gp*5cmp*gp*cp*tp *gp*ap*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: 5'-d(*gp*tp*cp*ap*gp*cp*gp*cp*ap*tp *cp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: SAH, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2uycA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkneriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.