PDB entry 2uy6

View 2uy6 on RCSB PDB site
Description: crystal structure of the p pilus rod subunit papa
Class: chaperone
Keywords: donor strand complementation, pili/n-terminal extension, pilus biogenesis, donor-strand exchange, nte, dsc, dse, papa, papd, fimbria, chaperone
Deposited on 2007-04-02, released 2007-05-29
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmid chaperone papd protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2uy6a1, d2uy6a2
  • Chain 'B':
    Compound: pap fimbrial major pilin protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04127 (Start-162)
      • engineered mutation (14)
      • engineered mutation (100)
  • Chain 'C':
    Compound: pap fimbrial major pilin protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04127 (Start-162)
      • engineered mutation (100)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uy6A (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uy6A (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkke
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.