PDB entry 2uxr

View 2uxr on RCSB PDB site
Description: complex with isocitrate and the protein isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila
Class: oxidoreductase
Keywords: psychrophilic, cold adaptation, thermal stability, isocitrate dehydrogenase, oxidoreductase
Deposited on 2007-03-29, released 2008-02-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: DESULFOTALEA PSYCHROPHILA [TaxId:84980]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2uxra_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: DESULFOTALEA PSYCHROPHILA [TaxId:84980]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2uxrb_
  • Heterogens: ICT, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uxrA (A:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uxrB (B:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uxrB (B:)
    mkiqktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaae
    aikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsvr
    swqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgihn
    tvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaagi
    eyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfey
    eaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaitie
    ciesgymtgdlaricepaaikvldsiefidelgkr